PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen12g003170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CPP
Protein Properties Length: 536aa    MW: 58347.6 Da    PI: 7.3363
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen12g003170.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-145695242
               TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                      ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  Sopen12g003170.1 56 KQKQCNCKHSRCLKLYCECFASGVYCDG-CNCNNCHNNVEN 95
                      89**************************.********9875 PP

2TCR51.12.7e-16140179140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Sopen12g003170.1 140 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 179
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.1E-165595IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.08856180IPR005172CRC domain
PfamPF036381.7E-115792IPR005172CRC domain
SMARTSM011148.4E-20140181IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12143178IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MSFFSCIPVE TGICEWPRGK KIDDNLDPLL ATLKPESPRA RPRQSASEVK DGTPKKQKQC  60
NCKHSRCLKL YCECFASGVY CDGCNCNNCH NNVENEPARR EAVEATLERN PHAFRPKIAS  120
SPHGARDNKE EAGDGLVLAK HNKGCHCKKS GCLKKYCECF QANILCSENC KCMDCKNFEG  180
SEERQALFHG DHANNMAYLQ QAANAAITGA IGSSGYGSPP VNKKRKSPEL FFGSTIKDPV  240
HRHGQLQQGN HIKSSVLPSL SSSPGPCVGN AATVGPSKFT YRSLLEDLIQ PQDLKELCSV  300
LVVYSGEAAK MLADEKDASK KQGEGQTQAS LASSTQEQVQ NQKDSGSEKD MLDCSSSGDQ  360
GEKISMKESS LDGADVSKRR PMSPGTLALM CDESDTMFAA AITSPDDLAT LGCNTSSQLP  420
HGQGMTETYA EQERIVLTKF RDCLNRLVTL GEIKEKKCSS MVRGIDFVDQ RDMIGNGFTT  480
TETRIQHDSF NKGVSNSPVP QPRTTQMFSS VATTANNNAL PKVHRPDENG DVKPTI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061276.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0V0IHB40.0A0A0V0IHB4_SOLCH; Uncharacterized protein
STRINGSolyc12g007180.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-172Tesmin/TSO1-like CXC domain-containing protein